Gene Cs7g01670.1
| Sequence ID | Cs7g01670.1 add to my list | ||
|---|---|---|---|
| Species | Citrus sinensis | ||
| Alias | No gene alias | ||
| Length | 279aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 279 amino acids
>Cs7g01670.1_CITSI MQHHELPTKNFTLKVDINHCNDCVEKAINKLKKMDGLHSVKYDTAKEMLKVSGSIDPEIL IQKFDKWGRKAELYSFDKDSLHIDNGKGKNCCSSKRKTHGVKIKDFDSSSDSSDDCDEEN CDSHAPKKVGKNISWQHPCLMKSSPKEENPMNKQSAKKSKKFFGGWFGKKDKAAKASGNK NTEGIASVKSPAASKWHFPRPSMPAYGVPGPFGYPPPPYGDRRLYHGNQYPPMMFARPMR PYYGYGLMPPPPYGLYQPRPPPRMNPMIHYTSYSDNYYP
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP252692 | Unannotated cluster |
| 3 | GP360682 | Unannotated cluster |
| 4 | GP493598 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cs7g01670.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT1G30473.1 | orthology | 1 | 3 | - | - |
| AT4G23882.1 | orthology | 1 | 2 | - | - |
| Cg7g023400.1 | orthology | 0.0141 | 2 | 516.5 | 9.7e-147 |
| Cm012520.1 | orthology | 0.0181 | 2 | 569.7 | 1.6e-162 |
| MELO3C015862.2.1 | orthology | 1 | 6 | - | - |
| brana_pan_p050558 | orthology | 1 | 4 | - | - |
| braol_pan_p028920 | orthology | 1 | 4 | - | - |
| cucsa_pan_p009937 | orthology | 1 | 6 | - | - |
| maldo_pan_p011650 | orthology | 1 | 5 | - | - |
| thecc_pan_p012699 | orthology | 1 | 3 | 114 | 3.55e-30 |