Gene Cs7g11080.1
| Sequence ID | Cs7g11080.1 add to my list | ||
|---|---|---|---|
| Species | Citrus sinensis | ||
| Alias | No gene alias | ||
| Length | 230aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 230 amino acids
>Cs7g11080.1_CITSI MGERKNRRKKINVPQNQGDEDKQSQERVEDIVLQVYMHCDGCATKVAHCLHGFDGVEKVK LDRANNKVIVSGEKAEPSKVIERIRKKYSTNAELISPKPKTNNGEDKKEPQKKQPQVKVV ILKMYMHCEGCARDIKKNIARIDGVLTVEPDMSKSQVTVKGEFDPPKLAEAITKRLGKFV EIVKEEAAKSKKNHKKDNENNMMHYPPQHPFNKNFYSCLSDEAIHSCFVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cs7g11080.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G02960.1 | orthology | 1 | 6 | 187.2 | 1.2e-47 |
| Cg7g016680.1 | orthology | 0.0282 | 1 | 354.4 | 5.2e-98 |
| Cm174370.1 | orthology | 0.0394 | 2 | 362.8 | 2.5e-100 |
| Manes.13G008700.1 | orthology | 0.802 | 3 | 209.9 | 1.9e-54 |
| brana_pan_p048220 | orthology | 1 | 7 | 199 | 1.5e-63 |
| braol_pan_p002896 | orthology | 1 | 7 | 194 | 6.67e-62 |
| brarr_pan_p015545 | orthology | 1 | 6 | 193 | 1.84e-61 |
| orange1.1t05450.1 | ultra-paralogy | 0.001 | 0 | - | - |
| thecc_pan_p009145 | orthology | 0.914 | 4 | 217 | 3.23e-71 |
| thecc_pan_p020513 | orthology | 1 | 4 | - | - |