Gene Cs9g05250.1
| Sequence ID | Cs9g05250.1 add to my list | ||
|---|---|---|---|
| Species | Citrus sinensis | ||
| Alias | No gene alias | ||
| Length | 140aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 140 amino acids
>Cs9g05250.1_CITSI MGKKKKHEELKLVVAEFKVSMYCNACERTVARAISKFKGVEKFTTDMNKHRVVVTGRIDP QKVLKKLKKKTGKKVEIVDNNNNNEESPKGCRNNEENEDSYRALLDKTNEDLAILFDCCK YNDEVLMMFSDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP345758 | Unannotated cluster |
| 4 | GP467256 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cs9g05250.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G21490.1 | orthology | 1 | 7 | 89 | 2.6e-18 |
| Ca_27_985.2 | orthology | 1 | 8 | - | - |
| Ca_34_139.2 | orthology | 1 | 8 | - | - |
| Ca_43_446.2 | orthology | 1 | 7 | - | - |
| Cc03_g02440 | orthology | 1 | 7 | 77 | 9.4e-15 |
| DCAR_030575 | orthology | 1 | 6 | 84 | 9.5e-17 |
| FvH4_3g29750.1 | orthology | 0.611 | 3 | 131.3 | 4.6e-31 |
| FvH4_4g16960.1 | orthology | 0.606 | 3 | - | - |
| HanXRQChr08g0226491 | orthology | 1 | 6 | 87.4 | 1.2e-17 |
| MELO3C021374.2.1 | orthology | 0.732 | 4 | 126.3 | 1.3e-29 |
| Manes.15G018700.1 | orthology | 0.767 | 5 | 114.8 | 5.1e-26 |
| Solyc03g098650.2.1 | orthology | 1 | 6 | 84 | 9e-17 |
| brana_pan_p026722 | orthology | 1 | 9 | 116 | 4.81e-34 |
| braol_pan_p034893 | orthology | 1 | 8 | 115 | 6.18e-34 |
| braol_pan_p054032 | orthology | 1 | 7 | - | - |
| brarr_pan_p010495 | orthology | 1 | 9 | 113 | 4.46e-33 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 | orthology | 0.607 | 3 | 114 | 8.6e-26 |
| cicar_pan_p022803 | orthology | 0.573 | 3 | 122 | 3.46e-37 |
| cucsa_pan_p017292 | orthology | 0.766 | 4 | 139 | 1.37e-43 |
| medtr_pan_p033077 | orthology | 0.611 | 3 | 134 | 1.73e-41 |
| phavu.G19833.gnm2.ann1.Phvul.003G099700.1 | orthology | 0.676 | 4 | 112.8 | 1.7e-25 |
| soybn_pan_p008694 | orthology | 0.615 | 4 | 139 | 1.49e-43 |
| soybn_pan_p032351 | orthology | 0.649 | 4 | - | - |
| thecc_pan_p001371 | orthology | 0.567 | 4 | 143 | 4.18e-45 |
| vitvi_pan_p022438 | orthology | 0.817 | 4 | 114 | 1.73e-33 |
| vitvi_pan_p032656 | orthology | 0.807 | 4 | - | - |