Gene Cs9g17280.1
Sequence ID | Cs9g17280.1 add to my list | ||
---|---|---|---|
Species | Citrus sinensis | ||
Alias | No gene alias | ||
Length | 136aa | ||
Gene Ontology |
![]()
|
Length: 136 amino acids
>Cs9g17280.1_CITSI MSLMVEVRVPNLDCEGCASKCKRALFKLKGVEEVEIEMEVQKITVRGYALDEKKVLKAIK RAGKAAEPWPFPGYAHFASFYKYPSYIVNHYYDTYGATNGAHTFFHTPAVYSVAVASDEA VASLFSDDNPHACTIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Cs9g17280.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G48970.1 | orthology | 0.34 | 5 | 205.7 | 1.9e-53 |
AUR62015981-RA | orthology | 0.387 | 6 | 222.6 | 2.5e-58 |
Bv3_055490_mxet.t1 | orthology | 0.419 | 6 | 219.9 | 8.9e-58 |
Ca_8_1007.1 | orthology | 0.314 | 9 | 216.1 | 3.7e-56 |
Cc02_g02970 | orthology | 0.314 | 9 | 216.1 | 1.3e-56 |
Cg9g026790.1 | orthology | 0 | 1 | 278.5 | 2.2e-75 |
Cm028340.1 | orthology | 0 | 1 | 278.5 | 3.6e-75 |
DCAR_009368 | orthology | 0.393 | 11 | 214.5 | 4.5e-56 |
FvH4_7g29520.1 | orthology | 0.161 | 4 | 235 | 2.9e-62 |
HanXRQChr06g0183831 | orthology | 0.395 | 6 | 214.9 | 4.9e-56 |
HanXRQChr09g0253621 | orthology | 0.423 | 6 | - | - |
MELO3C003319.2.1 | orthology | 0.37 | 6 | 199.1 | 1.5e-51 |
Manes.14G025900.1 | orthology | 0.193 | 4 | 238.8 | 2.3e-63 |
Mba01_g04690.1 | orthology | 0.642 | 11 | 176 | 1.8e-44 |
Oeu024220.1 | orthology | 0.288 | 8 | 221.9 | 3.9e-58 |
PGSC0003DMP400025270 | orthology | 0.307 | 11 | 223.8 | 7.1e-59 |
Solyc03g025790.2.1 | orthology | 0.297 | 11 | 222.6 | 1.6e-58 |
brana_pan_p044950 | orthology | 0.313 | 6 | 211 | 1.19e-71 |
braol_pan_p025375 | orthology | 0.313 | 7 | 214 | 4.89e-73 |
brarr_pan_p005835 | orthology | 0.313 | 7 | 214 | 4.36e-73 |
cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.189 | 7 | 240 | 1e-63 |
capan_pan_p012989 | orthology | 0.319 | 10 | 224 | 6.94e-77 |
cucsa_pan_p007884 | orthology | 0.337 | 6 | 208 | 1.82e-70 |
evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.606 | 9 | 188 | 3e-48 |
ipotf_pan_p019855 | orthology | 0.319 | 10 | 211 | 7.25e-72 |
ipotf_pan_p021461 | orthology | 0.49 | 10 | - | - |
itb03g13280.t1 | orthology | 0.319 | 10 | 209.5 | 1.5e-54 |
itb12g25750.t1 | orthology | 0.477 | 10 | - | - |
maldo_pan_p005834 | orthology | 0.166 | 4 | 239 | 7.35e-83 |
maldo_pan_p046866 | orthology | 0.591 | 4 | - | - |
medtr_pan_p031372 | orthology | 0.172 | 5 | 236 | 7.18e-82 |
musac_pan_p029616 | orthology | 0.628 | 11 | 179 | 4.86e-59 |
phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.187 | 7 | 241.9 | 2.4e-64 |
soybn_pan_p030070 | orthology | 0.163 | 6 | 211 | 4.93e-72 |
thecc_pan_p002573 | orthology | 0.141 | 4 | 247 | 2.81e-86 |
vitvi_pan_p028565 | orthology | 0.232 | 5 | 231 | 5.52e-80 |