Gene DCAR_003359
| Sequence ID | DCAR_003359 add to my list | ||
|---|---|---|---|
| Species | Daucus carota | ||
| Alias | No gene alias | ||
| Length | 232aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 232 amino acids
>DCAR_003359_DAUCA MTEKNIEGKDSVPKSDIVLGVLIHCQGCARSICSSLRGFEGVEEIEIDSKNHQVTVKGAR ADPIKVVERVRKKCGKHVELMTPVLSEEKKEEIKEEQKQEPRLVEITLKVNLHCPGCATD VKQTIHKLQGVVTVETYLKDSIVKVTGSMEPEKIVDLVKKREGKQAVIVKQEKKGGSGKK DDRKKNQTTGGEYQKGGRREKESSSIYANYPSHLVYAPQIFSDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP342504 | Unannotated cluster |
| 4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for DCAR_003359
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_73_71.2 | orthology | 0.858 | 3 | 164.5 | 2.2e-40 |
| Cc11_g17230 | orthology | 0.876 | 3 | 166.8 | 1.5e-41 |
| HanXRQChr01g0027281 | orthology | 1 | 3 | - | - |
| HanXRQChr08g0209971 | orthology | 1 | 3 | 176 | 4.3e-44 |
| Solyc05g009440.1.1 | orthology | 1 | 5 | 176.4 | 2.2e-44 |
| capan_pan_p013590 | orthology | 1 | 5 | - | - |
| ipotf_pan_p016439 | orthology | 1 | 5 | 173 | 4.4e-54 |
| itb13g20500.t1 | orthology | 1 | 5 | 136 | 3.6e-32 |