Gene DCAR_007285
Sequence ID | DCAR_007285 add to my list | ||
---|---|---|---|
Species | Daucus carota | ||
Alias | No gene alias | ||
Length | 144aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 144 amino acids
>DCAR_007285_DAUCA MGVLDHFSDLCSTSSTRKSKRKPMQTVDIKVKMDCDGCERRVKNSVSSMKGVKSVDVIRK QSRLTVTGYVEPNKVLKKVQSTGKRAEFWPYVPYNLVAQPYAPQAYDKKAPPGYVKKVVQ SPNAPVERYTTIFSDDNPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for DCAR_007285
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62014197-RA | orthology | 0.464 | 4 | 208.4 | 5.2e-54 |
AUR62024872-RA | orthology | 0.633 | 5 | - | - |
AUR62030676-RA | orthology | 0.605 | 5 | - | - |
Bv2_043150_njdu.t1 | orthology | 0.563 | 4 | 203.4 | 9.1e-53 |
Bv6_142690_rfcx.t1 | orthology | 0.821 | 5 | - | - |
Ca_9_830.1 | orthology | 0.376 | 3 | - | - |
Cc11_g08870 | orthology | 0.376 | 3 | 217.2 | 6e-57 |
DCAR_023613 | ultra-paralogy | 0.217 | 0 | - | - |
DCAR_026769 | ultra-paralogy | 0.187 | 0 | - | - |
HanXRQChr08g0212651 | orthology | 0.415 | 3 | 225.7 | 3e-59 |
Oeu036720.1 | orthology | 0.415 | 5 | - | - |
Oeu044351.1 | orthology | 0.398 | 5 | 223.8 | 1.1e-58 |
PGSC0003DMP400010633 | orthology | 0.475 | 8 | 218.8 | 2.4e-57 |
Solyc04g007630.1.1 | orthology | 0.469 | 8 | 219.2 | 1.8e-57 |
capan_pan_p011898 | orthology | 0.475 | 7 | 228 | 3.73e-78 |
capan_pan_p025493 | orthology | 0.416 | 7 | - | - |
capan_pan_p030603 | orthology | 0.485 | 7 | - | - |
ipotf_pan_p001332 | orthology | 0.696 | 7 | - | - |
ipotf_pan_p026205 | orthology | 0.701 | 7 | - | - |
ipotf_pan_p028506 | orthology | 0.558 | 7 | - | - |
itb04g14310.t1 | orthology | 0.675 | 7 | - | - |
itb07g07120.t1 | orthology | 0.55 | 7 | - | - |
itb14g01060.t2 | orthology | 0.701 | 7 | - | - |