Gene DCAR_009368
| Sequence ID | DCAR_009368 add to my list | ||
|---|---|---|---|
| Species | Daucus carota | ||
| Alias | No gene alias | ||
| Length | 138aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 138 amino acids
>DCAR_009368_DAUCA MSGVEVRVPNLDCEGCATKLRKALLKLKGVEDVDIDMEAQKVTVRGYALEEKKVLKAIKR TGKAAEPWPYPRGYTHFASFYKYPTHVANHYYDTSRNVAPGGVHSFFQTPSVYNVAVASD EAVASLFSDENPHACTVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for DCAR_009368
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.593 | 11 | 206.1 | 1.4e-53 |
| AUR62015981-RA | orthology | 0.546 | 10 | - | - |
| Bv3_055490_mxet.t1 | orthology | 0.579 | 10 | 213.4 | 8.4e-56 |
| Ca_8_1007.1 | orthology | 0.321 | 7 | 232.3 | 5.1e-61 |
| Cc02_g02970 | orthology | 0.321 | 7 | 229.9 | 8.5e-61 |
| Cg9g026790.1 | orthology | 0.393 | 11 | 217.2 | 6e-57 |
| Cm028340.1 | orthology | 0.393 | 11 | 217.2 | 1e-56 |
| Cs9g17280.1 | orthology | 0.393 | 11 | 217.2 | 6.5e-57 |
| FvH4_7g29520.1 | orthology | 0.433 | 12 | 218.4 | 2.8e-57 |
| HanXRQChr06g0183831 | orthology | 0.47 | 6 | - | - |
| HanXRQChr09g0253621 | orthology | 0.497 | 6 | 208.8 | 3.6e-54 |
| MELO3C003319.2.1 | orthology | 0.529 | 10 | 184.5 | 3.9e-47 |
| Manes.14G025900.1 | orthology | 0.466 | 12 | 226.9 | 9.1e-60 |
| Mba01_g04690.1 | orthology | 0.439 | 3 | 197.2 | 7.6e-51 |
| Oeu024220.1 | orthology | 0.209 | 4 | 233 | 1.7e-61 |
| PGSC0003DMP400025270 | orthology | 0.314 | 9 | 237.7 | 4.8e-63 |
| Solyc03g025790.2.1 | orthology | 0.304 | 9 | 237.3 | 6.3e-63 |
| brana_pan_p044950 | orthology | 0.566 | 12 | 211 | 1.29e-71 |
| braol_pan_p025375 | orthology | 0.566 | 13 | 211 | 1.25e-71 |
| brarr_pan_p005835 | orthology | 0.566 | 13 | 211 | 1.11e-71 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.442 | 13 | 216.9 | 9.3e-57 |
| capan_pan_p012989 | orthology | 0.327 | 8 | 234 | 5.76e-81 |
| cucsa_pan_p007884 | orthology | 0.496 | 10 | 189 | 1.13e-62 |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.483 | 3 | 188.7 | 1.8e-48 |
| ipotf_pan_p019855 | orthology | 0.326 | 8 | 221 | 8.58e-76 |
| ipotf_pan_p021461 | orthology | 0.498 | 8 | - | - |
| itb03g13280.t1 | orthology | 0.326 | 8 | 222.2 | 2.3e-58 |
| itb12g25750.t1 | orthology | 0.485 | 8 | - | - |
| maldo_pan_p005834 | orthology | 0.438 | 12 | 224 | 7.03e-77 |
| maldo_pan_p046866 | orthology | 0.863 | 12 | - | - |
| medtr_pan_p031372 | orthology | 0.425 | 11 | 220 | 1.97e-75 |
| musac_pan_p029616 | orthology | 0.425 | 3 | 197 | 1.82e-66 |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.44 | 13 | 219.9 | 9.9e-58 |
| soybn_pan_p030070 | orthology | 0.416 | 12 | 187 | 1.06e-62 |
| thecc_pan_p002573 | orthology | 0.413 | 12 | 226 | 7.39e-78 |
| vitvi_pan_p028565 | orthology | 0.36 | 7 | 223 | 1.35e-76 |