Gene DCAR_017683
Sequence ID | DCAR_017683 add to my list | ||
---|---|---|---|
Species | Daucus carota | ||
Alias | No gene alias | ||
Length | 335aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 335 amino acids
>DCAR_017683_DAUCA MGEKDDKKDGDKKSGAAPIPVVLKIDLHCEGCAKKVRRSVKHFEGVEKVTTDSANNKITV TGTLEPERLRERVEFKTKKKVELVSPQPKKDDKKPDAKPEKKADDKPEKKAEDKPEKKAE EKVEKKPKEVSTVILKIRLHCDGCIHKIKKIISKTDGVDNVMVDSKNDLVTVKGTMNVKE LVPYLQEKLKRSVEIVPAKKEGGGDKKEGGGDKKDGGGDKKEGGGDGDKKKDGGGGGGDA KVEMKKMDYHGLDPYTTFVVPPYGHSHSVHEYGSTSTPMYNRSYSNQDYGITNYDQGHVN HGYPVEYQYHHAPPPVYYNAPLMFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP540600 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for DCAR_017683
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_452_22.1 | orthology | 0.62 | 5 | - | - |
Ca_52_14.1 | orthology | 0.615 | 4 | - | - |
Ca_7_292.1 | orthology | 0.62 | 5 | - | - |
Cc06_g04230 | orthology | 0.608 | 5 | - | - |
DCAR_014996 | ultra-paralogy | 0.243 | 0 | - | - |
HanXRQChr01g0027741 | orthology | 0.698 | 1 | - | - |
HanXRQChr13g0401031 | orthology | 0.761 | 1 | - | - |
HanXRQChr14g0454431 | orthology | 0.637 | 1 | - | - |
HanXRQChr17g0570331 | orthology | 0.624 | 1 | - | - |
Oeu005022.1 | orthology | 0.675 | 4 | - | - |
Oeu016984.1 | orthology | 0.647 | 4 | - | - |
Oeu019283.1 | orthology | 0.609 | 4 | - | - |
Oeu045227.1 | orthology | 0.74 | 4 | - | - |
Oeu061953.1 | orthology | 0.673 | 4 | - | - |
PGSC0003DMP400006915 | orthology | 0.552 | 6 | - | - |
Solyc09g008200.2.1 | orthology | 0.592 | 6 | - | - |
Solyc10g086280.1.1 | orthology | 0.733 | 5 | - | - |
capan_pan_p000093 | orthology | 0.859 | 5 | - | - |
capan_pan_p021581 | orthology | 0.613 | 5 | - | - |
ipotf_pan_p002813 | orthology | 0.705 | 5 | - | - |
ipotf_pan_p014346 | orthology | 0.633 | 5 | - | - |
itb06g04100.t1 | orthology | 0.625 | 5 | - | - |
itb15g00310.t1 | orthology | 0.71 | 5 | - | - |