Gene DCAR_024797


Sequence ID DCAR_024797  add to my list
Species Daucus carota
Alias No gene alias
Length 129aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 129 amino acids

>DCAR_024797_DAUCA
MKLLLTGNDTASSDKFQFTPQSITAIGSIVLVEGCDQERSISWVHAWTLTDGVITQVVEL
KVGLHCDECIKKILKAVKKIEDIETYDVDTQLNKITVSGRVTTEEVMKALQKIGKQSTIW
EGASSAQLV





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP240412 Unannotated cluster
3 GP342479 Unannotated cluster
4 GP464531 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily
Wound-induced protein Wun1-like
IPR009798
Wound-induced protein Wun1-like Family

IPR006121 IPR036163 IPR009798
Figure 1: IPR domains for DCAR_024797



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cc02_g05820 orthology 0.698 4 105.9 1.7e-23
HanXRQChr08g0222621 orthology 0.643 1 109 3.6e-24
HanXRQChr15g0493871 orthology 0.69 1 - -
PGSC0003DMP400041420 orthology 0.519 3 114 7.5e-26
Solyc06g050710.2.1 orthology 0.555 4 109.8 1.4e-24
capan_pan_p032441 orthology 0.557 3 112 9.28e-34
ipotf_pan_p010921 orthology 0.841 5 103 3.9e-30
ipotf_pan_p028107 orthology 0.841 5 - -
itb12g24140.t1 orthology 0.841 5 102.1 3.2e-22