Gene DCAR_024797
| Sequence ID | DCAR_024797 add to my list | ||
|---|---|---|---|
| Species | Daucus carota | ||
| Alias | No gene alias | ||
| Length | 129aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 129 amino acids
>DCAR_024797_DAUCA MKLLLTGNDTASSDKFQFTPQSITAIGSIVLVEGCDQERSISWVHAWTLTDGVITQVVEL KVGLHCDECIKKILKAVKKIEDIETYDVDTQLNKITVSGRVTTEEVMKALQKIGKQSTIW EGASSAQLV
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP240412 | Unannotated cluster |
| 3 | GP342479 | Unannotated cluster |
| 4 | GP464531 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
|
Wound-induced protein Wun1-like
IPR009798
|
Wound-induced protein Wun1-like | Family |
Figure 1: IPR domains for DCAR_024797
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cc02_g05820 | orthology | 0.698 | 4 | 105.9 | 1.7e-23 |
| HanXRQChr08g0222621 | orthology | 0.643 | 1 | 109 | 3.6e-24 |
| HanXRQChr15g0493871 | orthology | 0.69 | 1 | - | - |
| PGSC0003DMP400041420 | orthology | 0.519 | 3 | 114 | 7.5e-26 |
| Solyc06g050710.2.1 | orthology | 0.555 | 4 | 109.8 | 1.4e-24 |
| capan_pan_p032441 | orthology | 0.557 | 3 | 112 | 9.28e-34 |
| ipotf_pan_p010921 | orthology | 0.841 | 5 | 103 | 3.9e-30 |
| ipotf_pan_p028107 | orthology | 0.841 | 5 | - | - |
| itb12g24140.t1 | orthology | 0.841 | 5 | 102.1 | 3.2e-22 |