Gene DCAR_025878


Sequence ID DCAR_025878  add to my list
Species Daucus carota
Alias No gene alias
Length 146aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 146 amino acids

>DCAR_025878_DAUCA
MGALDYLSNFCTVTSTRGKRKAMQTVEIKVKMDCDGCERRVKNAVKTMKGVKNLDVNRKQ
SRVTVSGYVDPNKVLKRVKSTGKRAEFWPYIPYNLVSYPYVAGAYDKRAPAGFVRNVTQA
VPPSNATDEKITHMFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for DCAR_025878



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_1_37.3 orthology 0.17 2 260.8 1.4e-69
Ca_25_217.3 orthology 0.17 2 - -
Ca_53_45.6 orthology 0.17 2 - -
Ca_74_24.3 orthology 0.17 2 - -
Cc07_g08240 orthology 0.17 2 260.8 4.8e-70
HanXRQChr12g0375901 orthology 0.233 3 - -
HanXRQChr17g0543461 orthology 0.215 3 256.1 2.1e-68
Oeu030808.1 orthology 0.232 4 255 4.5e-68
Oeu041969.1 orthology 0.295 4 - -
PGSC0003DMP400053293 orthology 0.334 6 231.9 2.8e-61
Solyc02g091300.2.1 orthology 0.314 6 236.9 8.7e-63
capan_pan_p020935 orthology 0.309 5 232 6.21e-80