Gene Dr00501


Sequence ID Dr00501  add to my list
Species Dioscorea rotundata
Alias No gene alias
Length 177aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 177 amino acids

>Dr00501_DIORT
MRIKFQSHLLLLIYISIGEHCTYPSRQLVKMFSFTRHKTISNAISTVELGVHMDCEGCEK
RIRKALAKLEGVDSVDIDMDKQKVTVTGYVDQNKVLKAVRRTGRKAEFWPYPYDSQYYPY
AIQYLEDDTYATTHNYYRHGYNSTVHGYFPDPAYTMIVDDDAAAIFNDDNVHACMIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Dr00501



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU6Hr1G066220.1 orthology 0.829 4 162.9 2.1e-40
Mba02_g11510.1 orthology 0.371 3 189.1 2.6e-48
Sspon.04G0006170-1A orthology 0.978 4 - -
Sspon.04G0023540-1B orthology 1 4 159.8 4.8e-39
XP_008783549.1 orthology 0.267 3 254.2 9.8e-68
XP_010934033.1 orthology 0.208 3 259.2 3.2e-69
cocnu_pan_p034578 orthology 0.246 2 228 4.37e-78
maize_pan_p014734 orthology 0.964 4 146 5.67e-46
musac_pan_p001552 orthology 0.321 3 242 2.43e-83
orysa_pan_p046445 orthology 0.612 3 209 2.9e-70
sorbi_pan_p005993 orthology 0.685 3 197 3.45e-65
tritu_pan_p005371 orthology 0.625 4 - -
tritu_pan_p026136 orthology 0.63 4 204 6.9e-68