Gene Dr07514


Sequence ID Dr07514  add to my list
Species Dioscorea rotundata
Alias No gene alias
Length 165aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 165 amino acids

>Dr07514_DIORT
MRTKSNGNRVPGMLCRSEAATAVCVPRERSVIVPQRAKRSTLVHHEHARLGYDLRYSRLK
DSRSFTSGDHRRAVTLPMVTKRQNLQVKPSSTSNDGQLFQVVVMKVSIHCQGCAGKVKKH
ISKMEGVTSFSIDLESKRVTVMGHVSPDGVLESISKVKKAEFWSC




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Dr07514



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU1Hr1G072500.1 orthology 0.602 4 159.1 2.8e-39
ORGLA08G0123900.1 orthology 0.629 3 147.9 6e-36
Sspon.06G0006620-1A orthology 0.578 1 - -
Sspon.06G0006620-2B orthology 0.588 1 156.8 3.8e-38
Sspon.06G0006620-3C orthology 0.592 2 - -
Sspon.06G0033720-1D orthology 0.588 1 - -
XP_008809313.1 orthology 0.444 4 199.9 2e-51
XP_010905917.1 orthology 0.443 5 185.7 4.2e-47
bradi_pan_p028136 orthology 0.619 3 157 2.23e-49
cocnu_pan_p015352 orthology 0.437 5 189 1.3e-62
maize_pan_p004511 orthology 0.596 1 150 3.09e-46
musac_pan_p004339 orthology 0.497 2 - -
orysa_pan_p015149 orthology 0.633 3 152 4.24e-47
orysa_pan_p029167 orthology 0.882 3 - -
sorbi_pan_p025104 orthology 0.559 1 153 1.24e-47
sorbi_pan_p025742 orthology 1 2 - -
tritu_pan_p039370 orthology 0.626 4 152 1.99e-47