Gene Dr20434
| Sequence ID | Dr20434 add to my list | ||
|---|---|---|---|
| Species | Dioscorea rotundata | ||
| Alias | No gene alias | ||
| Length | 146aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 146 amino acids
>Dr20434_DIORT MGRLRFERVLDCFSFPNCCTSYLCANAMEDEECERMTLIKVPEDQKLKLGDHLNNACKTL AFHLEPKTVVLRVSMHCNGCARKVEKHISKMEGVTSFEVDLQSKKVVVVGDINPFEVLDS VSKIKFAELVYSPKIIIHNETLQNFQ
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Dr20434
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba01_g17650.1 | orthology | 0.671 | 3 | 164.5 | 5.7e-41 |
| Mba08_g26390.1 | orthology | 0.697 | 3 | - | - |
| ORGLA01G0170900.1 | orthology | 1 | 2 | - | - |
| XP_008776942.1 | orthology | 0.593 | 2 | 175.3 | 4.8e-44 |
| XP_008809019.1 | orthology | 0.557 | 3 | - | - |
| XP_010925099.1 | orthology | 0.586 | 4 | 174.5 | 8.7e-44 |
| XP_010939249.1 | orthology | 0.611 | 3 | - | - |
| bradi_pan_p042928 | orthology | 1 | 3 | - | - |
| cocnu_pan_p000998 | orthology | 0.637 | 3 | - | - |
| cocnu_pan_p007495 | orthology | 0.629 | 4 | 171 | 4.51e-56 |
| maize_pan_p021681 | orthology | 1 | 3 | - | - |
| musac_pan_p002002 | orthology | 0.671 | 3 | 161 | 6.24e-52 |
| musac_pan_p039784 | orthology | 0.715 | 3 | - | - |
| sorbi_pan_p016251 | orthology | 1 | 3 | - | - |
| tritu_pan_p003582 | orthology | 1 | 3 | - | - |