Gene FvH4_3g07830.1
Sequence ID | FvH4_3g07830.1 add to my list | ||
---|---|---|---|
Species | Fragaria vesca | ||
Alias | No gene alias | ||
Length | 170aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 170 amino acids
>FvH4_3g07830.1_FRAVE MTIVEMQVHMDCSGCENKIKKALKKIKGVDDIDVDINMQKVTVMGWAKQEKVLKAVRRTG RTAELWPYPYNPEYGHNLNVQYYQQHQPRDGHEHHHHHHNHHDRGEHRSKHNITTYNSIP NYSSYSYNYYKHGYSGMEHGYYQPPPYSTMFSEQDTAVFSDDNPNSCSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP542154 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for FvH4_3g07830.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg7g011400.1 | orthology | 0.745 | 6 | 145.2 | 3.6e-35 |
Cm129650.1 | orthology | 0.77 | 6 | 138.3 | 7.3e-33 |
Manes.17G055500.1 | orthology | 0.713 | 5 | 154.8 | 5.4e-38 |
cajca.ICPL87119.gnm1.ann1.C.cajan_31664.1 | orthology | 0.722 | 6 | - | - |
cicar_pan_p021456 | orthology | 0.84 | 6 | - | - |
maldo_pan_p003465 | orthology | 0.404 | 1 | - | - |
maldo_pan_p053909 | orthology | 0.365 | 1 | 236 | 1.89e-80 |
soybn_pan_p018217 | orthology | 0.683 | 5 | 153 | 2.29e-48 |
thecc_pan_p000996 | orthology | 0.589 | 2 | 174 | 1.04e-56 |