Gene FvH4_4g18950.1
Sequence ID | FvH4_4g18950.1 add to my list | ||
---|---|---|---|
Species | Fragaria vesca | ||
Alias | No gene alias | ||
Length | 305aa | ||
Gene Ontology |
![]()
|
Length: 305 amino acids
>FvH4_4g18950.1_FRAVE MVPELEKPRITEIHVRMDCNGCVQKIKKALHGISGIYDLYIDFPQQKLTIIGWADPEKIV KAIKKTRKIATICSHIEQPTEPAPPPAEQPPEGGAAPPPDAANPPTESPPPAEPTPPPEA VPPAEPPKDPPPPEHAPPPRPPEALPTPVAAETNLGQQHPVYHHRPREVGEVRTIHHYPP DYGYRYGYPNGYPGYYNRYHNNQGPPPEPTPPPAQAPSPSPPVQVHAPPPVYVTHSYNTY RPSPYVTEYEYVQPPPPQQTHYSRISQYHHYNEDQPYHNVSSNGNGNGNITSIFSDENPN ACAVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP047778 | Unannotated cluster |
4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for FvH4_4g18950.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg9g002000.1 | orthology | 0.561 | 5 | 155.2 | 6.2e-38 |
Cm229420.1 | orthology | 0.564 | 5 | 155.2 | 1e-37 |
Cs9g03680.1 | orthology | 0.578 | 4 | 151.4 | 9.7e-37 |
Manes.15G008800.1 | orthology | 0.591 | 4 | 188 | 1e-47 |
cajca.ICPL87119.gnm1.ann1.C.cajan_04327.1 | orthology | 0.863 | 4 | 140.6 | 1.9e-33 |
cajca.ICPL87119.gnm1.ann1.C.cajan_31773.1 | orthology | 0.724 | 5 | 194 | 3.36e-61 |
cicar_pan_p002360 | orthology | 0.94 | 5 | 140 | 2.44e-40 |
maldo_pan_p004517 | orthology | 0.26 | 1 | 275 | 4.41e-91 |
maldo_pan_p022412 | orthology | 0.279 | 1 | - | - |
medtr_pan_p024125 | orthology | 0.963 | 5 | 106 | 3.94e-27 |
phavu.G19833.gnm2.ann1.Phvul.003G108900.1 | orthology | 0.937 | 5 | 130.2 | 2.3e-30 |
soybn_pan_p005812 | orthology | 0.861 | 4 | - | - |
soybn_pan_p009634 | orthology | 0.895 | 5 | - | - |
soybn_pan_p012740 | orthology | 0.695 | 5 | 138 | 3.77e-39 |
thecc_pan_p016610 | orthology | 0.528 | 3 | 218 | 4.52e-69 |
vitvi_pan_p020280 | orthology | 0.451 | 3 | 202 | 8.65e-64 |