Gene FvH4_5g10380.1
Sequence ID | FvH4_5g10380.1 add to my list | ||
---|---|---|---|
Species | Fragaria vesca | ||
Alias | No gene alias | ||
Length | 194aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 194 amino acids
>FvH4_5g10380.1_FRAVE MATSLKRTFGSILSSIVYLFYTNDHHHDQRYHQHHHQHHHHKSSRSNIHKLKYNMPRGRP LSLQTVELKVRMCCTGCERVVKHAIFKLKGIDSVEVDLPMEKVTVVGYVERNKVLKAVRR AGKRAEFWPDHPLYFTSTSDYFRDTTNEFKESYNYYKHGYNIGDKHGTLPVAHRGDDKVS NMFNDDNVNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for FvH4_5g10380.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HanXRQChr14g0462111 | orthology | 0.491 | 3 | - | - |
HanXRQChr17g0534061 | orthology | 0.436 | 3 | 191.8 | 6.4e-49 |
MELO3C005805.2.1 | orthology | 0.423 | 4 | 188 | 4.9e-48 |
cucsa_pan_p009482 | orthology | 0.427 | 4 | 204 | 1.05e-67 |
maldo_pan_p015603 | orthology | 0.239 | 1 | 224 | 3.28e-75 |
maldo_pan_p024088 | orthology | 0.251 | 1 | - | - |