Gene FvH4_5g10380.1
| Sequence ID | FvH4_5g10380.1 add to my list | ||
|---|---|---|---|
| Species | Fragaria vesca | ||
| Alias | No gene alias | ||
| Length | 194aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 194 amino acids
>FvH4_5g10380.1_FRAVE MATSLKRTFGSILSSIVYLFYTNDHHHDQRYHQHHHQHHHHKSSRSNIHKLKYNMPRGRP LSLQTVELKVRMCCTGCERVVKHAIFKLKGIDSVEVDLPMEKVTVVGYVERNKVLKAVRR AGKRAEFWPDHPLYFTSTSDYFRDTTNEFKESYNYYKHGYNIGDKHGTLPVAHRGDDKVS NMFNDDNVNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for FvH4_5g10380.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HanXRQChr14g0462111 | orthology | 0.491 | 3 | - | - |
| HanXRQChr17g0534061 | orthology | 0.436 | 3 | 191.8 | 6.4e-49 |
| MELO3C005805.2.1 | orthology | 0.423 | 4 | 188 | 4.9e-48 |
| cucsa_pan_p009482 | orthology | 0.427 | 4 | 204 | 1.05e-67 |
| maldo_pan_p015603 | orthology | 0.239 | 1 | 224 | 3.28e-75 |
| maldo_pan_p024088 | orthology | 0.251 | 1 | - | - |