Gene FvH4_5g12320.1
| Sequence ID | FvH4_5g12320.1 add to my list | ||
|---|---|---|---|
| Species | Fragaria vesca | ||
| Alias | No gene alias | ||
| Length | 174aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 174 amino acids
>FvH4_5g12320.1_FRAVE MHDTPFPFPILSHALLHFTINFLVLVYSIIPPFRILQQSYYISLKSDHKFMTDKFCCMLM RINIDCNGCYRKVKRALLDMRELETHLIEKKECRVSVYGRFIPQDVAIKIRKKTNRRVEI LDIQELQVITNTTNDNEQDQRQEQQRPLLSSNWNLISNSCDNRMETRILNEKYY
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for FvH4_5g12320.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv5_110870_wcqq.t1 | orthology | 1 | 7 | 117.1 | 1e-26 |
| Bv5_110870_wcqq.t2 | orthology | 1 | 7 | - | - |
| CgUng002450.1 | orthology | 0.735 | 4 | 132.5 | 2.4e-31 |
| Cm118330.1 | orthology | 0.733 | 3 | 130.6 | 1.6e-30 |
| Cs7g26570.1 | orthology | 0.735 | 4 | 132.5 | 2.7e-31 |
| Manes.05G138100.1 | orthology | 0.759 | 4 | 112.1 | 4.1e-25 |
| PGSC0003DMP400010112 | orthology | 1 | 6 | 109 | 3.2e-24 |
| Solyc03g119630.2.1 | orthology | 1 | 7 | 115.5 | 3.4e-26 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 | orthology | 1 | 5 | 116.3 | 2.1e-26 |
| capan_pan_p000343 | orthology | 1 | 7 | - | - |
| cicar_pan_p024669 | orthology | 1 | 6 | 117 | 9.67e-35 |
| cucsa_pan_p010693 | orthology | 1 | 7 | 124 | 4.06e-37 |
| maldo_pan_p026714 | orthology | 0.469 | 1 | 137 | 3.19e-42 |
| medtr_pan_p036900 | orthology | 1 | 6 | 122 | 1.91e-36 |
| phavu.G19833.gnm2.ann1.Phvul.004G158700.1 | orthology | 1 | 5 | 116.3 | 1.9e-26 |
| soybn_pan_p040036 | orthology | 1 | 5 | - | - |
| soybn_pan_p040183 | orthology | 0.969 | 5 | 132 | 2.11e-40 |
| soybn_pan_p040952 | orthology | 0.946 | 5 | - | - |
| soybn_pan_p042566 | orthology | 1 | 5 | - | - |
| thecc_pan_p001600 | orthology | 0.92 | 6 | 140 | 9.12e-43 |
| vitvi_pan_p014384 | orthology | 0.804 | 5 | 136 | 6e-41 |