Gene FvH4_5g30890.1


Sequence ID FvH4_5g30890.1  add to my list
Species Fragaria vesca
Alias No gene alias
Length 193aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 193 amino acids

>FvH4_5g30890.1_FRAVE
MMSMKSSTSTAAKKKKTTMMPRGFMCHSQAATAVCVSSADAARSDIISSGARNTRMINNN
YNARYSKIVESRRFVNPADHGNKPVLLSSMIKREPTLNYHHHHHYSKPKMSLQKTPSVLP
SADNVFQVVVMRVALHCQGCAGKVKKHLSKMEGVTSFSIDLETKMVTVRGHVSPVGVVES
ISKVKKAELLPSS




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for FvH4_5g30890.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Oeu026170.2 orthology 0.655 3 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_22288.1 orthology 0.735 6 143.3 1.8e-34
cajca.ICPL87119.gnm1.ann1.C.cajan_22881.1 orthology 0.689 6 - -
cicar_pan_p022227 orthology 0.78 5 - -
cocnu_pan_p025689 orthology 0.457 2 - -
maldo_pan_p006499 orthology 0.383 1 132 7.99e-39
medtr_pan_p011208 orthology 0.752 5 145 2.47e-44
medtr_pan_p033339 orthology 0.793 5 - -
phavu.G19833.gnm2.ann1.Phvul.002G207200.1 orthology 0.692 6 142.9 2.1e-34
phavu.G19833.gnm2.ann1.Phvul.006G207900.1 orthology 0.86 6 - -
soybn_pan_p021093 orthology 0.671 5 - -
soybn_pan_p025312 orthology 0.713 5 - -
soybn_pan_p029731 orthology 0.706 5 139 6.6e-42