Gene HORVU0Hr1G010200.1
Sequence ID | HORVU0Hr1G010200.1 add to my list |
---|---|
Species | Hordeum vulgare |
Alias | No gene alias |
Length | 188aa |
Length: 188 amino acids
>HORVU0Hr1G010200.1_HORVU EVHVDQANHKITVVGIADPQRIVKAIRRTNRVPTICSHTDPAAPAPPAEGEAPPAAPAPL AEGEAPAADAPPPPPAEEAPAEPTAAEDKEAPPAEAPDSTMIYMVRDCPCSYHAYKGHWA NHPSSIHGVRYDAAAPCYAAHSRSYSPYISEYGHVGYCHPAAAASGRGDGSQITSMFSEE NPNACSIA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP047778 | Unannotated cluster |
4 | GP077656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU5Hr1G010460.1 | ultra-paralogy | 0.0162 | 0 | - | - |
evm_27.model.AmTr_v1.0_scaffold00003.117 | orthology | 1 | 2 | 56.2 | 1.9e-08 |
tritu_pan_p002566 | orthology | 0.106 | 1 | - | - |
tritu_pan_p045619 | orthology | 0.0926 | 1 | 219 | 2.29e-72 |