Gene HORVU1Hr1G072500.1


Sequence ID HORVU1Hr1G072500.1  add to my list
Species Hordeum vulgare
Alias F2CTL7
Length 192aa
PubMed References
Open Display PubMed Reference(s) (1)
Accession Description
Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.
21415278 		Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 192 amino acids

>HORVU1Hr1G072500.1_HORVU
MRAGGMLCRSQAATAVCVPGDARSMVVGRRADRATIAEDARVLHDVRYVRLGGAGAGCDG
PGATRVSSRRVAPPPPPPMPRRRGAPVAVTLPMVTKSPVETPARDTAAAKRAPAAPTAAV
APGDQILQVVVMKVAIHCQGCAGKVRKHISKMEGVTSFSIDLESKKVTVMGHVSPAGVLE
SISKVKKAELLM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HORVU1Hr1G072500.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr07514 orthology 0.602 4 151.4 5.3e-37
ORGLA08G0123900.1 orthology 0.153 4 213.8 1e-55
XP_008809313.1 orthology 0.637 7 158.3 7.9e-39
XP_010905917.1 orthology 0.636 8 148.3 8.7e-36
bradi_pan_p028136 orthology 0.108 2 288 1.32e-100
cocnu_pan_p015352 orthology 0.63 8 167 1.6e-53
musac_pan_p004339 orthology 0.69 5 - -
orysa_pan_p015149 orthology 0.157 4 257 4.41e-88
orysa_pan_p029167 orthology 0.406 4 - -
tritu_pan_p039370 orthology 0.05 1 313 3.18e-110