Gene HORVU2Hr1G093870.1


Sequence ID HORVU2Hr1G093870.1  add to my list
Species Hordeum vulgare
Alias No gene alias
Length 123aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 123 amino acids

>HORVU2Hr1G093870.1_HORVU
MGDLQIVLAGGTIEAQHVEMKVPLYSYGCEKKIKKALSNLKGIHSVQVDYHQQKVTVWGI
CNRNDVLAAVRRKRRAARFWGADQPDLAGEDARLGDAPKHYLRAFAAYRTRKSWKKLFPM
IRL




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP467872 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HORVU2Hr1G093870.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba04_g24060.1 orthology 0.735 6 148.3 3.6e-36
XP_008808278.1 orthology 0.822 6 148.7 4e-36
XP_010919018.1 orthology 0.829 7 151 8.6e-37
XP_010934032.1 orthology 0.787 6 - -
bradi_pan_p042306 orthology 0.132 2 224 3.81e-77
cocnu_pan_p020678 orthology 0.803 6 148 1.76e-47
cocnu_pan_p024529 orthology 0.877 7 - -
musac_pan_p009117 orthology 0.75 6 149 8.91e-48
orysa_pan_p048607 orthology 0.188 3 213 5.83e-73
orysa_pan_p051674 orthology 0.651 3 - -
tritu_pan_p012747 orthology 0.0181 1 244 3e-85
tritu_pan_p017403 orthology 0.0268 1 - -
tritu_pan_p047012 orthology 0.0096 1 - -