Gene HORVU3Hr1G004420.1
| Sequence ID | HORVU3Hr1G004420.1 add to my list | ||
|---|---|---|---|
| Species | Hordeum vulgare | ||
| Alias | No gene alias | ||
| Length | 428aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 428 amino acids
>HORVU3Hr1G004420.1_HORVU MTDGCTSQNMLHWSPVLLCRNFYHGSRATCEPSPSASLRVCGCVVVGVYSVAIDVDNHKV TVTGSVDSEALIRKLTRGGKHAELWSHHKGGSNNSNQGHKGGNNNQQKQQQQQQQKQAVN VSKDGGGGNKGNGGQKEQGKHGGGGGGMGSLMQGLKAFKSQHGKHQLPDLSSDDDDDMYD DEDDEDDDEFDDEYEDDLRFLGDKMSQLGILRQRAEAAAAVNAKNKNGSNAANAGGKKGA PAGNNHHQNNNQNQKMNMGAAAANAKMGNGAQKNAGGGIGGLMGMNHGLGTGGAPPGIQA YTGGGFSHPSSYGAAGYGGLQQQQQQQQNGNLMASMQGYHNNPAAAAAMMNNLRGNMMMH QPQPQPQPQMMYHRSPQISPYTAYYNPYSYYYQQPGGGGASAYHPGGAGTGDVETMFSDE NTKGCAIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HORVU3Hr1G004420.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Dr15259 | orthology | 0.898 | 3 | - | - |
| Mba02_g23430.1 | orthology | 1 | 4 | - | - |
| Mba03_g01140.1 | orthology | 0.881 | 4 | 93.2 | 1.09e-20 |
| Mba10_g22160.1 | orthology | 0.931 | 4 | - | - |
| XP_008806263.1 | orthology | 0.733 | 3 | 86.3 | 3.09e-18 |
| XP_010916342.1 | orthology | 0.772 | 5 | - | - |
| XP_010926063.1 | orthology | 0.757 | 4 | - | - |
| XP_019707202.1 | orthology | 0.757 | 4 | - | - |
| XP_026656869.1 | orthology | 0.78 | 4 | - | - |
| cocnu_pan_p016981 | orthology | 0.769 | 4 | - | - |
| cocnu_pan_p021838 | orthology | 0.75 | 5 | - | - |
| cocnu_pan_p035969 | orthology | 0.75 | 5 | - | - |
| musac_pan_p029655 | orthology | 0.992 | 4 | - | - |
| musac_pan_p029948 | orthology | 0.927 | 4 | - | - |
| musac_pan_p030748 | orthology | 0.864 | 3 | - | - |
| musac_pan_p032325 | orthology | 0.863 | 4 | - | - |
| tritu_pan_p033683 | orthology | 0.091 | 1 | - | - |
| tritu_pan_p038784 | orthology | 0.0804 | 1 | 415 | 2.59e-143 |
| tritu_pan_p048092 | orthology | 0.0919 | 1 | - | - |