Gene HORVU3Hr1G004420.1
Sequence ID | HORVU3Hr1G004420.1 add to my list | ||
---|---|---|---|
Species | Hordeum vulgare | ||
Alias | No gene alias | ||
Length | 428aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 428 amino acids
>HORVU3Hr1G004420.1_HORVU MTDGCTSQNMLHWSPVLLCRNFYHGSRATCEPSPSASLRVCGCVVVGVYSVAIDVDNHKV TVTGSVDSEALIRKLTRGGKHAELWSHHKGGSNNSNQGHKGGNNNQQKQQQQQQQKQAVN VSKDGGGGNKGNGGQKEQGKHGGGGGGMGSLMQGLKAFKSQHGKHQLPDLSSDDDDDMYD DEDDEDDDEFDDEYEDDLRFLGDKMSQLGILRQRAEAAAAVNAKNKNGSNAANAGGKKGA PAGNNHHQNNNQNQKMNMGAAAANAKMGNGAQKNAGGGIGGLMGMNHGLGTGGAPPGIQA YTGGGFSHPSSYGAAGYGGLQQQQQQQQNGNLMASMQGYHNNPAAAAAMMNNLRGNMMMH QPQPQPQPQMMYHRSPQISPYTAYYNPYSYYYQQPGGGGASAYHPGGAGTGDVETMFSDE NTKGCAIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HORVU3Hr1G004420.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr15259 | orthology | 0.898 | 3 | - | - |
Mba02_g23430.1 | orthology | 1 | 4 | - | - |
Mba03_g01140.1 | orthology | 0.881 | 4 | 93.2 | 1.09e-20 |
Mba10_g22160.1 | orthology | 0.931 | 4 | - | - |
XP_008806263.1 | orthology | 0.733 | 3 | 86.3 | 3.09e-18 |
XP_010916342.1 | orthology | 0.772 | 5 | - | - |
XP_010926063.1 | orthology | 0.757 | 4 | - | - |
XP_019707202.1 | orthology | 0.757 | 4 | - | - |
XP_026656869.1 | orthology | 0.78 | 4 | - | - |
cocnu_pan_p016981 | orthology | 0.769 | 4 | - | - |
cocnu_pan_p021838 | orthology | 0.75 | 5 | - | - |
cocnu_pan_p035969 | orthology | 0.75 | 5 | - | - |
musac_pan_p029655 | orthology | 0.992 | 4 | - | - |
musac_pan_p029948 | orthology | 0.927 | 4 | - | - |
musac_pan_p030748 | orthology | 0.864 | 3 | - | - |
musac_pan_p032325 | orthology | 0.863 | 4 | - | - |
tritu_pan_p033683 | orthology | 0.091 | 1 | - | - |
tritu_pan_p038784 | orthology | 0.0804 | 1 | 415 | 2.59e-143 |
tritu_pan_p048092 | orthology | 0.0919 | 1 | - | - |