Gene HORVU3Hr1G072940.2


Sequence ID HORVU3Hr1G072940.2  add to my list
Species Hordeum vulgare
Alias No gene alias
Length 157aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 157 amino acids

>HORVU3Hr1G072940.2_HORVU
MLPWSITCQIVEMCVHMCCAGCEKKIRKAVEKLEGVHAVEIDMEMQKVTVSGDVDQKKVL
KTVRRTGKRAVLWPTPFIAGAGAGAGGAVNLLAQQHQYHPGGAQMYATHASGSTSSYNYY
KHGYDDSRLYGANSAVVGGTRATDYFSDENTGGCSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HORVU3Hr1G072940.2



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba03_g16740.1 orthology 0.527 4 - -
XP_008813766.1 orthology 0.639 5 151.4 7.9e-37
XP_010920018.1 orthology 0.651 6 148.7 5.5e-36
bradi_pan_p002062 orthology 0.21 2 216 3.02e-73
cocnu_pan_p020915 orthology 0.659 6 - -
musac_pan_p001588 orthology 0.547 4 158 1.93e-50
tritu_pan_p029517 orthology 0.0455 1 282 3.27e-99