Gene HORVU3Hr1G114920.1


Sequence ID HORVU3Hr1G114920.1  add to my list
Species Hordeum vulgare
Alias F2DC24, F2D8P1
Length 359aa
PubMed References
Open Display PubMed Reference(s) (2)
Accession Description
Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.
21415278 		Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.
A physical, genetic and functional sequence assembly of the barley genome.
23075845 		A physical, genetic and functional sequence assembly of the barley genome.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 359 amino acids

>HORVU3Hr1G114920.1_HORVU
WSTSFGFGVGPSLPSKGASLKAGTHIQIQYKPKKKRTIIHFIVHHQPNPKTHSNSMASLL
LKGVHKRLGLPSISISCSSADATNIIASTGSVAGVGSSSGRAIDRHSPRLRDPHRTSTST
SKPPRPSTSTKDSPSSDSSKTKRQHGHGNKKKKSTTAAAGTSEKRLVSPATSSRFLLNSS
RLQSDDLDVLALPPPPPPSFIDVFPGGEGKPASFIDAFPRDASLALSFAKEAQSPAQQAQ
SSSSSSSASSSSEITAVKEEEQQEKAAVLARSSSTTAARTTQVVVVLRVSLHCKGCAGKV
KKHIAKMEGVTSIDIDIASKKVTVVGDVTPLGVLTSVSKVKPAQFWPSQPCPPRASASF




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HORVU3Hr1G114920.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
tritu_pan_p000519 orthology 0.088 1 - -
tritu_pan_p009091 orthology 0.106 1 301 2.57e-101
tritu_pan_p040818 orthology 0.102 1 - -
tritu_pan_p052444 orthology 0.109 1 - -