Gene HORVU4Hr1G046610.1


Sequence ID HORVU4Hr1G046610.1  add to my list
Species Hordeum vulgare
Alias F2DRN2
Length 371aa
PubMed References
Open Display PubMed Reference(s) (1)
Accession Description
Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.
21415278 		Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 371 amino acids

>HORVU4Hr1G046610.1_HORVU
LSSQRLESHRLERLLPKRDKVISPQGALPSHPMASGQPAVQTFVLRVTIHCHGCKKKVRK
VLKSIEGVHDVKVDAQQHKVMVTGTVDAETLVKRLHKSGKQALPWQHTPAKNPEPAPSPS
TPTDAPAPAEDGSNDAAVADKKPAVPAKEPQTSSSDKKPEQETSPEKKPEMDKEAEPEKK
AEKEEAKPSDESKKAGGEGAAAEPKAKGTEPAETTKEAGNNEGEGKKKQSKPKDADRSLP
PAPAHVPRHPHHEFNPYNAPQPVMSYNMAQPRASVSHYAPQPEQGYSQPQAGYSSMTQHS
PAQQAYSQHAQPMQQWSPSYLYMPYPHASPESYYQDYYSPPGTNASPPPPPPLHDSYSLF
DDENPNSCSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP023608 Unannotated cluster
3 GP040483 Unannotated cluster
4 GP070015 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HORVU4Hr1G046610.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AUR62008611-RA orthology 1 4 - -
Bv7_164120_fciq.t1 orthology 1 4 - -
evm_27.model.AmTr_v1.0_scaffold00016.303 orthology 1 2 - -
tritu_pan_p002683 orthology 0.128 1 - -
tritu_pan_p044639 orthology 0.137 1 402 2.17e-140
tritu_pan_p045179 orthology 0.15 1 - -
tritu_pan_p051083 orthology 0.333 1 - -