Gene HanXRQChr01g0029661
Sequence ID | HanXRQChr01g0029661 add to my list |
---|---|
Species | Helianthus annuus |
Alias | No gene alias |
Length | 59aa |
Length: 59 amino acids
>HanXRQChr01g0029661_HELAN MDHIVSTNKLFGGTTPRTMSKEWQDETEKMKNAWPRTAGPPVVLNPLTRQNFIVNSRDS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for HanXRQChr01g0029661
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
evm_27.model.AmTr_v1.0_scaffold00109.87 | orthology | 0.746 | 1 | - | - |
evm_27.model.AmTr_v1.0_scaffold00110.70 | orthology | 0.744 | 1 | - | - |