Gene HanXRQChr01g0029661


Sequence ID HanXRQChr01g0029661  add to my list
Species Helianthus annuus
Alias No gene alias
Length 59aa



Length: 59 amino acids

>HanXRQChr01g0029661_HELAN
MDHIVSTNKLFGGTTPRTMSKEWQDETEKMKNAWPRTAGPPVVLNPLTRQNFIVNSRDS





Clustering Level Family ID Family Name
1
Unknown function duf1138 family
GP002478
Unknown function duf1138 family
2 GP018276 Unannotated cluster
3 GP042981 Unannotated cluster
4 GP072479 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Protein of unknown function DUF1138
IPR009515
Protein of unknown function DUF1138 Family

IPR009515
Figure 1: IPR domains for HanXRQChr01g0029661



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
evm_27.model.AmTr_v1.0_scaffold00109.87 orthology 0.746 1 - -
evm_27.model.AmTr_v1.0_scaffold00110.70 orthology 0.744 1 - -