Gene HanXRQChr01g0030091
| Sequence ID | HanXRQChr01g0030091 add to my list |
|---|---|
| Species | Helianthus annuus |
| Alias | No gene alias |
| Length | 68aa |
Length: 68 amino acids
>HanXRQChr01g0030091_HELAN MRVNLHYDGCKHKVKKFLQRIDAEVMKSLNIPNGACPQPIIGPPRGRSELSNMRCLYLDM ELATTIRV
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HanXRQChr08g0212661 | ultra-paralogy | 0.903 | 0 | - | - |
| HanXRQChr10g0317181 | ultra-paralogy | 0.711 | 0 | - | - |
| HanXRQChr12g0377611 | ultra-paralogy | 1 | 0 | - | - |
| HanXRQChr17g0566971 | ultra-paralogy | 1 | 0 | - | - |