Gene HanXRQChr06g0168381


Sequence ID HanXRQChr06g0168381  add to my list
Species Helianthus annuus
Alias No gene alias
Length 201aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 201 amino acids

>HanXRQChr06g0168381_HELAN
MRTPGVHKVDVKHEKGEIRVEGTFEVKKIHERLEKWSRKKVEILSQDKKLMEKKETKKEI
IKTTKIKAYMHCDKCEHDLRAKLLKHKGIHNVKTDIKSQTILVEGTIEAEKIVTYIQKRA
RKHAEIIPEPLPKEKVEKKVEETVVEKKVEEKVTVTTKVVEFEEKKKVEAKGKDDEVPYF
VHYVYAPQLFSDENPNACLVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP342504 Unannotated cluster
4 GP464372 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HanXRQChr06g0168381



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_46_563.1 orthology 0.6 4 - -
Ca_64_447.2 orthology 0.596 5 174.9 1.4e-43
Cc02_g26130 orthology 0.596 5 191.8 3.7e-49
DCAR_029550 orthology 0.652 2 193.7 1.2e-49
Oeu036922.1 orthology 0.58 4 - -
PGSC0003DMP400011529 orthology 0.74 6 151 8.6e-37
Solyc10g039390.1.1 orthology 0.793 6 161 8.2e-40
capan_pan_p023451 orthology 0.767 5 147 1.23e-45
ipotf_pan_p011107 orthology 0.699 5 184 9.71e-59
itb09g19040.t1 orthology 0.722 5 90.1 2e-18