Gene HanXRQChr08g0222621
| Sequence ID | HanXRQChr08g0222621 add to my list | ||
|---|---|---|---|
| Species | Helianthus annuus | ||
| Alias | No gene alias | ||
| Length | 75aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 75 amino acids
>HanXRQChr08g0222621_HELAN MTNVVELKVGLHCEECIKMILKAIKKIQDIETYDVDTRLNKVTVTGNVTNAQVVKALHKI GKQATNWEQGSTTSY
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP240412 | Unannotated cluster |
| 3 | GP342479 | Unannotated cluster |
| 4 | GP464531 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HanXRQChr08g0222621
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cc02_g05820 | orthology | 0.486 | 4 | 111.3 | 2.4e-25 |
| DCAR_024797 | orthology | 0.643 | 1 | 108.2 | 2.5e-24 |
| HanXRQChr15g0493871 | ultra-paralogy | 0.32 | 0 | - | - |
| PGSC0003DMP400041420 | orthology | 0.307 | 3 | 119.4 | 1e-27 |
| Solyc06g050710.2.1 | orthology | 0.343 | 4 | 119.4 | 1e-27 |
| capan_pan_p032441 | orthology | 0.345 | 3 | 112 | 1.56e-34 |
| ipotf_pan_p010921 | orthology | 0.628 | 5 | 107 | 1.42e-32 |
| ipotf_pan_p028107 | orthology | 0.628 | 5 | - | - |
| itb12g24140.t1 | orthology | 0.628 | 5 | 107.1 | 5.8e-24 |