Gene HanXRQChr08g0236461
| Sequence ID | HanXRQChr08g0236461 add to my list | ||
|---|---|---|---|
| Species | Helianthus annuus | ||
| Alias | No gene alias | ||
| Length | 278aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 278 amino acids
>HanXRQChr08g0236461_HELAN MGEEEKKPEKAEEEAKLSAGDEKKEEESKDPLPPPPPQEVVLRVFMHCEGCARKVRRCLK GFEGIEDVITDCTTHKVTVKGEKADPLKVLERLQKKSHRKVELISPVPTPPAEEPKKPEQ EEATPKPEEKKDEPPPVITVVLKVHMHCEACAQEIRKRILRMKGVESAVPDLKNSQVMVK GTFSAVELVDYVHKRTGKTAVMVKQDPEPKPEDEKSENNEDGEKKEDKNDRDGGEKQEAG EKEDTTVAAVEMRKNEYYYYYYQPANYQLYPHYYKIEL
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HanXRQChr08g0236461
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AUR62029568-RA | orthology | 0.646 | 2 | - | - |
| AUR62038839-RA | orthology | 0.605 | 2 | - | - |
| Bv5_126430_ujxr.t1 | orthology | 0.576 | 2 | - | - |
| HanXRQChr05g0155871 | ultra-paralogy | 0.327 | 0 | - | - |
| HanXRQChr09g0273401 | ultra-paralogy | 0.598 | 0 | - | - |
| HanXRQChr16g0498291 | ultra-paralogy | 0.46 | 0 | - | - |