Gene HanXRQChr08g0236461
Sequence ID | HanXRQChr08g0236461 add to my list | ||
---|---|---|---|
Species | Helianthus annuus | ||
Alias | No gene alias | ||
Length | 278aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 278 amino acids
>HanXRQChr08g0236461_HELAN MGEEEKKPEKAEEEAKLSAGDEKKEEESKDPLPPPPPQEVVLRVFMHCEGCARKVRRCLK GFEGIEDVITDCTTHKVTVKGEKADPLKVLERLQKKSHRKVELISPVPTPPAEEPKKPEQ EEATPKPEEKKDEPPPVITVVLKVHMHCEACAQEIRKRILRMKGVESAVPDLKNSQVMVK GTFSAVELVDYVHKRTGKTAVMVKQDPEPKPEDEKSENNEDGEKKEDKNDRDGGEKQEAG EKEDTTVAAVEMRKNEYYYYYYQPANYQLYPHYYKIEL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for HanXRQChr08g0236461
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62029568-RA | orthology | 0.646 | 2 | - | - |
AUR62038839-RA | orthology | 0.605 | 2 | - | - |
Bv5_126430_ujxr.t1 | orthology | 0.576 | 2 | - | - |
HanXRQChr05g0155871 | ultra-paralogy | 0.327 | 0 | - | - |
HanXRQChr09g0273401 | ultra-paralogy | 0.598 | 0 | - | - |
HanXRQChr16g0498291 | ultra-paralogy | 0.46 | 0 | - | - |