Gene HanXRQChr09g0250681
| Sequence ID | HanXRQChr09g0250681 add to my list |
|---|---|
| Species | Helianthus annuus |
| Alias | No gene alias |
| Length | 160aa |
Length: 160 amino acids
>HanXRQChr09g0250681_HELAN MTETQTIIDEECIPMKYDKTPVKIRFCFPVVAGITGLGGSLTRDQKRISVGDCILKRHCS GINQRLTIVNKAVIATETFKKARVYESCRAAEPSTRHMETGYVTAATGANICDLHRVSRD AIRQKRSRTLVDHKGRCLNIYPPKFGLASPSPVQLLLHKI
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP260293 | Unannotated cluster |
| 3 | GP373365 | Unannotated cluster |
| 4 | GP518609 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cm050080.1 | orthology | 1 | 4 | - | - |
| Cm050100.1 | orthology | 1 | 4 | - | - |
| Cs6g17830.1 | orthology | 1 | 3 | - | - |
| maldo_pan_p044873 | orthology | 1 | 1 | - | - |