Gene HanXRQChr10g0316141
Sequence ID | HanXRQChr10g0316141 add to my list |
---|---|
Species | Helianthus annuus |
Alias | No gene alias |
Length | 54aa |
Length: 54 amino acids
>HanXRQChr10g0316141_HELAN MVASKRTGRGRVILNFWKQFVVKMGFLDLFCAASMPVLKVLIVTALGSFLALDY
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Auxin efflux carrier family
GP000355 |
Auxin efflux carrier family |
2 | GP015273 | Unannotated cluster |
3 | GP040583 | Unannotated cluster |
4 | GP463693 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.