Gene HanXRQChr10g0316141
| Sequence ID | HanXRQChr10g0316141 add to my list |
|---|---|
| Species | Helianthus annuus |
| Alias | No gene alias |
| Length | 54aa |
Length: 54 amino acids
>HanXRQChr10g0316141_HELAN MVASKRTGRGRVILNFWKQFVVKMGFLDLFCAASMPVLKVLIVTALGSFLALDY
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Auxin efflux carrier family
GP000355 |
Auxin efflux carrier family |
| 2 | GP015273 | Unannotated cluster |
| 3 | GP040583 | Unannotated cluster |
| 4 | GP463693 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.