Gene HanXRQChr11g0322281


Sequence ID HanXRQChr11g0322281  add to my list
Species Helianthus annuus
Alias No gene alias
Length 168aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 168 amino acids

>HanXRQChr11g0322281_HELAN
MSQTVVLKVGMSCGGCAGAVKRVLSNMEGVETFDIDLEQKKVTVKGNVEPDAVLQTVSKT
GKKTEFWPKEASPCCCGPKKTVEPVAAPSSEAGEVVETVVAPSCGAAKPVESVAAPSCGA
AKPVEPVAAPSCGATKPVDAPSSEAAKPVEPVAAPSSEAEKPVETVVA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for HanXRQChr11g0322281



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg1g022220.1 orthology 0.679 2 - -
Cg3g009570.1 orthology 0.68 1 - -
Cg7g009800.1 orthology 0.618 2 - -
Cm109130.1 orthology 0.632 2 - -
Cm121490.1 orthology 0.664 1 - -
Cs2g08850.1 orthology 0.679 2 - -
HanXRQChr07g0194221 ultra-paralogy 0.166 0 - -
HanXRQChr08g0217841 ultra-paralogy 0.294 0 - -
HanXRQChr12g0368131 ultra-paralogy 0.294 0 - -
PGSC0003DMP400040663 orthology 0.677 4 - -
Solyc05g055310.2.1 orthology 0.677 4 - -
capan_pan_p024732 orthology 0.735 3 - -
orange1.1t01168.1 orthology 0.648 2 - -
orange1.1t01542.2 orthology 0.647 2 - -