Gene HanXRQChr11g0336651
| Sequence ID | HanXRQChr11g0336651 add to my list |
|---|---|
| Species | Helianthus annuus |
| Alias | No gene alias |
| Length | 87aa |
Length: 87 amino acids
>HanXRQChr11g0336651_HELAN MLYQFKQMTGAKIVGALAGSFALAFACDYVIADKKIFGGTTPSTVSNKEWWEETDKKFQA WPRTAGPPVVMNPISRQNFIVKSKAES
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.