Gene HanXRQChr14g0443861
Sequence ID | HanXRQChr14g0443861 add to my list |
---|---|
Species | Helianthus annuus |
Alias | No gene alias |
Length | 91aa |
Length: 91 amino acids
>HanXRQChr14g0443861_HELAN MGIVVVRLILLPFFGILIVKGAIYFSLVHVDPLYLFVLLLQYALPPAMNIGTITQLFGAG ETECSVIMLWTYGLASFSLTFWSMFFMWFVA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Auxin efflux carrier family
GP000355 |
Auxin efflux carrier family |
2 | GP015273 | Unannotated cluster |
3 | GP040583 | Unannotated cluster |
4 | GP463648 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.