Gene HanXRQChr14g0448911
| Sequence ID | HanXRQChr14g0448911 add to my list |
|---|---|
| Species | Helianthus annuus |
| Alias | No gene alias |
| Length | 64aa |
Length: 64 amino acids
>HanXRQChr14g0448911_HELAN MTMKKNQIHNENDGGNGGGGGGDGGKKQKPSDINVVVLKIDLYCEGCASRVVACCCSCSY TRWC
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP474217 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| PGSC0003DMP400046920 | orthology | 1 | 1 | - | - |
| Solyc06g073070.1.1 | orthology | 1 | 3 | - | - |
| capan_pan_p006811 | orthology | 1 | 2 | - | - |