Gene MELO3C003095.2.1
Sequence ID | MELO3C003095.2.1 add to my list | ||
---|---|---|---|
Species | Cucumis melo | ||
Alias | No gene alias | ||
Length | 277aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 277 amino acids
>MELO3C003095.2.1_CUCME MKTIDFFCASQASTAVDQPSSTPATVAAAGRFIDRHNPIIADGRRSNVTSRTNFPNPPCS SQYSPINPLPYHQLHAAASPNVAGDQIRSENHKDLKMKKKKKKIKKSSSIVTTDFVRWSC AKPSDLATPPGSMRYLLNDKSVRDGSMDRISTPIPIHKNLTPSDQQHPHQPQPTPQISSD DHCNKSPPSNQVVVLRVSLHCRGCEGKLRKHLSKMEGVNSFNIDFAAKKVTIMGNITPQG MLESVSKVKNAQFWPYADPTPNPNLNRNHHPNGLEKT
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C003095.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT2G37390.1 | orthology | 1 | 3 | 138 | 1.07e-39 |
AT3G53530.2 | orthology | 0.988 | 3 | - | - |
brana_pan_p029929 | orthology | 1 | 5 | - | - |
brana_pan_p030312 | orthology | 1 | 5 | - | - |
brana_pan_p031480 | orthology | 1 | 4 | - | - |
brana_pan_p036701 | orthology | 1 | 5 | 149 | 1.8e-43 |
brana_pan_p041953 | orthology | 1 | 4 | - | - |
braol_pan_p003859 | orthology | 1 | 4 | - | - |
braol_pan_p015324 | orthology | 1 | 4 | - | - |
braol_pan_p021666 | orthology | 1 | 4 | 145 | 7.95e-42 |
braol_pan_p031578 | orthology | 1 | 4 | - | - |
brarr_pan_p002630 | orthology | 1 | 5 | 151 | 1.77e-44 |
brarr_pan_p008392 | orthology | 1 | 5 | - | - |
brarr_pan_p026146 | orthology | 1 | 5 | - | - |
brarr_pan_p039884 | orthology | 1 | 4 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_09762.1 | orthology | 0.908 | 4 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_37472.1 | orthology | 0.864 | 5 | 204.1 | 1.2e-52 |
cicar_pan_p008704 | orthology | 0.926 | 4 | 162 | 2.6e-49 |
cicar_pan_p017889 | orthology | 0.949 | 4 | - | - |
cucsa_pan_p020833 | orthology | 0.0692 | 1 | 434 | 1.19e-155 |
medtr_pan_p001385 | orthology | 0.931 | 4 | - | - |
medtr_pan_p025678 | orthology | 0.947 | 4 | 180 | 7.83e-56 |
phavu.G19833.gnm2.ann1.Phvul.001G171400.1 | orthology | 0.92 | 5 | - | - |
phavu.G19833.gnm2.ann1.Phvul.L001741.1 | orthology | 0.933 | 5 | 204.5 | 8.6e-53 |
soybn_pan_p015281 | orthology | 0.912 | 5 | - | - |
soybn_pan_p025035 | orthology | 0.924 | 5 | - | - |
soybn_pan_p025142 | orthology | 0.83 | 4 | 211 | 9.88e-68 |