Gene MELO3C005315.2.1
Sequence ID | MELO3C005315.2.1 add to my list | ||
---|---|---|---|
Species | Cucumis melo | ||
Alias | No gene alias | ||
Length | 148aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 148 amino acids
>MELO3C005315.2.1_CUCME MGIVGFVSDYVTDNFGSRKKKRKPNQTVEIKVKMDCDGCERRIKNAVSSVKGVKSVKVDR KQSKVTVNGYAEATKVLKKVESTGKKAELWPYVPYNSVAYPYVPQAYDKKAPPGYVKKAP QALPVDEALDQRLTMMFSDENPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C005315.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg2g033960.1 | orthology | 0.662 | 6 | - | - |
Cg2g033970.1 | orthology | 0.531 | 5 | - | - |
Cm053240.1 | orthology | 0.662 | 6 | - | - |
Cm053250.1 | orthology | 0.545 | 6 | - | - |
Cs2g13790.1 | orthology | 0.538 | 6 | - | - |
Cs2g13800.1 | orthology | 0.67 | 5 | - | - |
Manes.15G126400.1 | orthology | 0.45 | 3 | - | - |
Manes.17G075300.1 | orthology | 0.504 | 3 | - | - |
cucsa_pan_p007548 | orthology | 0.0074 | 1 | 292 | 7.32e-104 |
thecc_pan_p004875 | orthology | 0.437 | 4 | - | - |