Gene MELO3C005805.2.1
| Sequence ID | MELO3C005805.2.1 add to my list | ||
|---|---|---|---|
| Species | Cucumis melo | ||
| Alias | No gene alias | ||
| Length | 192aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 192 amino acids
>MELO3C005805.2.1_CUCME ATVLHRTTLGSIIYSYFLRCFGNSHNHNNNLDLHHHHHHHKSFNHIFFNNMPKPKPLSLQ TVELKVRMCCTGCERVVKDAIYKLRGVDSVEVDLELEKVTVIGYVDRNKVLKVVRRAGKR AEFWPYPEPPLYFTSATDYFKDTTREFKESYNYYRHGYNVGEKHGTIPMSHRGDDKVSNM FNDDNVNACHVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C005805.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_5g10380.1 | orthology | 0.423 | 4 | 187.6 | 7.3e-48 |
| HanXRQChr14g0462111 | orthology | 0.4 | 2 | 209 | 1.36e-69 |
| HanXRQChr17g0534061 | orthology | 0.345 | 2 | 203 | 2.7e-52 |
| cucsa_pan_p009482 | orthology | 0.0046 | 1 | 317 | 2.55e-112 |
| maldo_pan_p015603 | orthology | 0.353 | 4 | - | - |
| maldo_pan_p024088 | orthology | 0.365 | 4 | 213 | 5.47e-71 |