Gene MELO3C007779.2.1
| Sequence ID | MELO3C007779.2.1 add to my list | ||
|---|---|---|---|
| Species | Cucumis melo | ||
| Alias | No gene alias | ||
| Length | 151aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 151 amino acids
>MELO3C007779.2.1_CUCME MGVGGTLEYLSDLVGNTHKHKKKKQLQTVELKVRMDCDGCELKVKNALSSLSGVKSVEIN RKQQKVTVTGYVEASKVLKKAKSTGKKAEIWPYVPYSLVSQPYIAQAYDKKAPPGYVRNV EQTATTASVTKYEDPYINMFSDDNPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C007779.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg1g028830.1 | orthology | 0.148 | 4 | 238.4 | 2.7e-63 |
| Cm206550.1 | orthology | 0.142 | 4 | 240.4 | 1.2e-63 |
| Cs1g01860.1 | orthology | 0.148 | 3 | 238 | 3.9e-63 |
| FvH4_1g21640.1 | orthology | 0.173 | 5 | 241.5 | 3.4e-64 |
| Manes.12G139000.1 | orthology | 0.143 | 4 | - | - |
| Manes.13G090400.1 | orthology | 0.17 | 4 | 265.8 | 1.9e-71 |
| cucsa_pan_p001819 | orthology | 0.014 | 1 | 300 | 5.75e-107 |
| maldo_pan_p008643 | orthology | 0.182 | 5 | 264 | 2.74e-92 |