Gene MELO3C011555.2.1
| Sequence ID | MELO3C011555.2.1 add to my list |
|---|---|
| Species | Cucumis melo |
| Alias | No gene alias |
| Length | 150aa |
Length: 150 amino acids
>MELO3C011555.2.1_CUCME MIERERHRLIVFGRFKPSDIAIKIRKKMNRRVEILDVEEMEPLPATDQNPPPPENIQGPG PGPGPGPNADQHHIPMFPSLEQADHGRPPMFPSLAANQCRSYPSCRPDFGVTCFPEPDME ERFWEYGYDYEVVGDREERPTISLHNYYHY
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| cajca.ICPL87119.gnm1.ann1.C.cajan_20295.1 | orthology | 0.7 | 3 | 64.3 | 8.3e-11 |
| cucsa_pan_p020069 | orthology | 0.0714 | 1 | 266 | 9.63e-93 |
| medtr_pan_p029809 | orthology | 0.759 | 3 | 59.3 | 5.16e-12 |
| phavu.G19833.gnm2.ann1.Phvul.003G034700.1 | orthology | 0.74 | 4 | 64.3 | 7.5e-11 |
| soybn_pan_p037786 | orthology | 0.794 | 4 | 66.2 | 4.72e-15 |