Gene MELO3C012358.2.1


Sequence ID MELO3C012358.2.1  add to my list
Species Cucumis melo
Alias No gene alias
Length 116aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 116 amino acids

>MELO3C012358.2.1_CUCME
MSQTSDGNHSNRANEVKVRESSIETTVLKVAMSCQGCVGAVKRVLGKLEGVDTFDIDIDA
QKVTVKGNVERDVVFQTVSKTGKKTAYWEDDASAAPAATPAPAEAEAKPAEPLAAA





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for MELO3C012358.2.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
FvH4_7g05820.1 orthology 0.342 3 84.3 5.3e-17
cucsa_pan_p012118 orthology 0.0568 1 169 1.56e-56
maldo_pan_p006752 orthology 0.357 3 - -
maldo_pan_p024825 orthology 0.371 3 125 1.31e-38