Gene MELO3C012358.2.1
Sequence ID | MELO3C012358.2.1 add to my list | ||
---|---|---|---|
Species | Cucumis melo | ||
Alias | No gene alias | ||
Length | 116aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 116 amino acids
>MELO3C012358.2.1_CUCME MSQTSDGNHSNRANEVKVRESSIETTVLKVAMSCQGCVGAVKRVLGKLEGVDTFDIDIDA QKVTVKGNVERDVVFQTVSKTGKKTAYWEDDASAAPAATPAPAEAEAKPAEPLAAA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C012358.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
FvH4_7g05820.1 | orthology | 0.342 | 3 | 84.3 | 5.3e-17 |
cucsa_pan_p012118 | orthology | 0.0568 | 1 | 169 | 1.56e-56 |
maldo_pan_p006752 | orthology | 0.357 | 3 | - | - |
maldo_pan_p024825 | orthology | 0.371 | 3 | 125 | 1.31e-38 |