Gene MELO3C013353.2.1
| Sequence ID | MELO3C013353.2.1 add to my list | ||
|---|---|---|---|
| Species | Cucumis melo | ||
| Alias | No gene alias | ||
| Length | 154aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 154 amino acids
>MELO3C013353.2.1_CUCME MGVLDHLSDYFDCSSHGSKHKKRKQLQTVELKIRIDCEGCERKVKRALEGMKGVKQVDVD RKSNKATVVGYVEPSKVVARVAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPAGYVRK ADDPNVYQLARASSTEVRYTTAFSDENPAACVVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C013353.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg8g001620.1 | orthology | 0.185 | 3 | 271.9 | 2.3e-73 |
| Cm237380.1 | orthology | 0.204 | 4 | 268.1 | 5.5e-72 |
| Cs8g02620.1 | orthology | 0.192 | 4 | 270.8 | 5.5e-73 |
| Manes.04G076000.1 | orthology | 0.171 | 3 | 272.3 | 2.1e-73 |
| cucsa_pan_p008172 | orthology | 0.0198 | 1 | 294 | 2.82e-104 |