Gene MELO3C020306.2.1
| Sequence ID | MELO3C020306.2.1 add to my list | ||
|---|---|---|---|
| Species | Cucumis melo | ||
| Alias | No gene alias | ||
| Length | 167aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 167 amino acids
>MELO3C020306.2.1_CUCME MFHLSFIYFFGFCFVGIRKKGEEMGALDYLSNFCIVTPTRTKHKPMQTVEIKVKMDCDGC ERRVRNAVTSMKGVQSVEVMRKQHRVRVIGYVDANKVLKRVKSTGKRAEFWPYIPQHLVH HPYAFGAYDKKAPSGFVRNVVQAFPTPHEENYVSFFSDDNVHACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C020306.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| cajca.ICPL87119.gnm1.ann1.C.cajan_32061.1 | orthology | 0.343 | 5 | 236.5 | 1.4e-62 |
| cucsa_pan_p006945 | orthology | 0.0246 | 1 | 296 | 4.13e-105 |
| medtr_pan_p021579 | orthology | 0.397 | 3 | 211 | 3.1e-71 |
| phavu.G19833.gnm2.ann1.Phvul.004G001200.1 | orthology | 0.336 | 4 | 239.6 | 1.5e-63 |
| soybn_pan_p022431 | orthology | 0.464 | 5 | - | - |
| soybn_pan_p025671 | orthology | 0.439 | 5 | 218 | 9.42e-74 |
| soybn_pan_p036295 | orthology | 0.665 | 5 | - | - |
| soybn_pan_p036417 | orthology | 0.596 | 5 | - | - |
| soybn_pan_p037957 | orthology | 0.863 | 5 | - | - |
| soybn_pan_p038110 | orthology | 0.44 | 5 | - | - |
| soybn_pan_p043279 | orthology | 0.711 | 5 | - | - |