Gene MELO3C021404.2.1
Sequence ID | MELO3C021404.2.1 add to my list | ||
---|---|---|---|
Species | Cucumis melo | ||
Alias | No gene alias | ||
Length | 317aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 317 amino acids
>MELO3C021404.2.1_CUCME MSKEEFLKIQKCVLKVNIHCDGCKQKVKKILQKIDGVFTTDIDAELGKVTVSGNVDAATL IKKLSKSGKYAELWGAPKVNPNNNNGGHQNHLANQMKNLQIDSGKNGGNNNKQGPPKGGN NQPKLGGGGGGGGGGGPPQILPQQLQQLQQLQQQMNGFPFQDPKMLPPQLKGMKMPPFKD PIPANQNQKAVKFDLPEDGDLTDDDYDDDDYDDDDFDEDDDLEDDLDDIPLPPNKMKTPI GGAGAGAVPGGGGGGGGGQMPNLLMMNGMNGMNGNMNIQQLINAQKAAANGADKKLAVAV WRWLGGGVLYVQMPLYQ
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C021404.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G06130.1 | orthology | 0.524 | 3 | - | - |
AT5G19090.1 | orthology | 0.539 | 3 | 162.9 | 3.2e-40 |
brana_pan_p014467 | orthology | 0.692 | 5 | - | - |
brana_pan_p014790 | orthology | 0.527 | 3 | - | - |
brana_pan_p016251 | orthology | 0.694 | 3 | - | - |
brana_pan_p035280 | orthology | 0.544 | 4 | 182 | 5.37e-53 |
brana_pan_p037105 | orthology | 0.558 | 4 | - | - |
brana_pan_p042083 | orthology | 0.558 | 4 | - | - |
brana_pan_p046785 | orthology | 0.527 | 4 | - | - |
brana_pan_p057676 | orthology | 0.822 | 4 | - | - |
brana_pan_p070531 | orthology | 0.86 | 4 | - | - |
brana_pan_p072847 | orthology | 0.559 | 4 | - | - |
braol_pan_p001592 | orthology | 0.559 | 4 | - | - |
braol_pan_p007803 | orthology | 0.552 | 4 | - | - |
braol_pan_p034967 | orthology | 0.694 | 5 | - | - |
braol_pan_p040751 | orthology | 0.527 | 4 | - | - |
brarr_pan_p000054 | orthology | 0.556 | 4 | - | - |
brarr_pan_p004859 | orthology | 0.701 | 4 | - | - |
brarr_pan_p021889 | orthology | 0.546 | 4 | - | - |
brarr_pan_p028538 | orthology | 0.528 | 4 | - | - |
cucsa_pan_p012169 | orthology | 0.0575 | 1 | 384 | 2.43e-131 |