Gene MELO3C024466.2.1
| Sequence ID | MELO3C024466.2.1 add to my list | ||
|---|---|---|---|
| Species | Cucumis melo | ||
| Alias | No gene alias | ||
| Length | 359aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 359 amino acids
>MELO3C024466.2.1_CUCME MGEKVLEAPKNNDGEKKPADAGQKKDDGAVTAVFKIDMHCDGCAKKVKRVVKHLDGVSDV KADPSSNKLTVTGKVDPAVIKTKLEQKTKKKIEIVSPQPKKEGGGDKKPDEKTEKKTDEK AEKKTDEKGEKKADGKSEKKSDEKAEKKPEEKKSEDKKAKESTVVLKMRLHCEGCIQKIR KALIKFKGVNEISVDAQKDLITVKGTIEGKDLQSYLKDKFNRSVEVIPPKKEEPAAGGEK KEKEAGGGGGEKKDNDGKPAAASSGGDGGGAKVEVVNKYKYSGFSYPPSTFYYDAPSHSH THQYSYAMEAQPSYPVYGFANSSGYYANPNYVQQGYSTPMNDHTQMFSDENPNAACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C024466.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| CgUng002500.1 | orthology | 0.536 | 7 | - | - |
| CgUng019980.1 | orthology | 0.536 | 7 | - | - |
| Cm060230.1 | orthology | 0.538 | 5 | 202 | 1.4e-62 |
| FvH4_6g16410.1 | orthology | 0.624 | 3 | 181 | 1.3e-45 |
| Manes.08G010600.1 | orthology | 0.636 | 4 | 198 | 1.83e-60 |
| Manes.09G066300.1 | orthology | 0.663 | 4 | - | - |
| cucsa_pan_p001888 | orthology | 0.06 | 1 | 454 | 8.3e-161 |
| maldo_pan_p018618 | orthology | 0.59 | 3 | 221 | 4.62e-69 |
| maldo_pan_p021518 | orthology | 0.604 | 3 | - | - |
| orange1.1t00956.1 | orthology | 0.539 | 6 | - | - |