Gene MELO3C025323.2.1
Sequence ID | MELO3C025323.2.1 add to my list | ||
---|---|---|---|
Species | Cucumis melo | ||
Alias | No gene alias | ||
Length | 113aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 113 amino acids
>MELO3C025323.2.1_CUCME MGKLKKMGKVFDCFSYSSNSCSSNSCFCINSMKIEDEEDEFFDKQPLIADNNKKDNQLLT LKDVVNGNQTLAFQLKPKISVFESKEMVTLRVSMHCKGCARKVEKHISKMEGN
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for MELO3C025323.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cajca.ICPL87119.gnm1.ann1.C.cajan_15643.1 | orthology | 0.504 | 3 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_27569.1 | orthology | 0.578 | 4 | 99 | 2.3e-21 |
cicar_pan_p021514 | orthology | 0.479 | 3 | 108 | 3.31e-32 |
cucsa_pan_p016074 | orthology | 0.0421 | 1 | 197 | 1.09e-66 |
medtr_pan_p011917 | orthology | 0.533 | 2 | - | - |
medtr_pan_p025294 | orthology | 0.516 | 3 | 108 | 1.04e-31 |
phavu.G19833.gnm2.ann1.Phvul.002G314600.1 | orthology | 0.564 | 4 | - | - |
phavu.G19833.gnm2.ann1.Phvul.004G161300.1 | orthology | 0.554 | 3 | 103.6 | 8.4e-23 |
soybn_pan_p011905 | orthology | 0.519 | 4 | - | - |
soybn_pan_p021997 | orthology | 0.533 | 4 | 105 | 3.1e-30 |