Gene Manes.01G148900.1


Sequence ID Manes.01G148900.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 151aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 151 amino acids

>Manes.01G148900.1_MANES
MGLLDFFSAHQHDSKKLKKSKQLKTVEIKVRMDCEGCERKVKKAVEGMKGVTKVEVEPKQ
HKLTVTGYVDPNKVLQRVRHRTGKKADFWPYVPYDLVPHPYAPGAYDKKAPPGYVRNVVD
DSAAPLAHASSFEVKTLSAFSDENPNACVIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.01G148900.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT5G66110.1 orthology 0.385 3 209.9 1.1e-54
Cg1g001350.1 orthology 0.397 6 232.3 2e-61
Cm173610.1 orthology 0.391 5 239.6 2.1e-63
Cm280940.1 orthology 0.391 5 236 4.47e-81
Cs1g25820.1 orthology 0.391 6 237.3 6.7e-63
MELO3C007926.2.1 orthology 0.327 3 231.5 3e-61
brana_pan_p030902 orthology 0.391 5 194 6.25e-65
braol_pan_p039277 orthology 0.383 4 - -
brarr_pan_p021369 orthology 0.391 5 - -
cucsa_pan_p018650 orthology 0.327 3 228 3.57e-78
maldo_pan_p003753 orthology 0.332 3 - -
medtr_pan_p005386 orthology 0.475 5 223 4.98e-76
thecc_pan_p011891 orthology 0.403 5 227 7.9e-78