Gene Manes.02G038800.1


Sequence ID Manes.02G038800.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 109aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 109 amino acids

>Manes.02G038800.1_MANES
MVTLANNSLMHFEDLTLPSFQVIVMSGSIGCARCRQRVSQVIAKMTGLREYTVDVKRKQV
IVKGDFGNQQKQEDDYSKSEMNKERGNCHPLRLLLGSFVASCFRKQVAD





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP022701 Unannotated cluster
3 GP047979 Unannotated cluster
4 GP468909 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.02G038800.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT2G35730.1 orthology 1 5 - -
Cm212920.1 orthology 1 1 93.2 1.7e-19
brana_pan_p001635 orthology 1 6 77 2.14e-19
brana_pan_p054319 orthology 1 6 - -
braol_pan_p040844 orthology 1 6 77 1.94e-19
braol_pan_p052965 orthology 1 6 - -
brarr_pan_p008654 orthology 1 5 79.3 3.58e-20
cajca.ICPL87119.gnm1.ann1.C.cajan_01523.1 orthology 1 6 90.5 8e-19
cicar_pan_p024775 orthology 1 5 80.1 5.8e-21
cucsa_pan_p023048 orthology 1 3 79.7 5.11e-21
maize_pan_p044279 orthology 1 4 - -
medtr_pan_p004416 orthology 1 5 79.3 1.64e-20
phavu.G19833.gnm2.ann1.Phvul.003G219900.1 orthology 1 6 80.1 9.7e-16
soybn_pan_p039239 orthology 1 5 85.5 6.64e-23
soybn_pan_p043513 orthology 1 5 - -
soybn_pan_p045249 orthology 1 5 - -