Gene Manes.02G074200.1


Sequence ID Manes.02G074200.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 146aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 146 amino acids

>Manes.02G074200.1_MANES
MGALDYLSNFCTVTTTRSKRKPMQTVEIKVKMDCDGCERRVKNAVSTMKGVKTVEVNRKQ
SRVVVSGYVDPNKVLKRVKSTGKRAEFWPYIPQHLVYYPYAAGAYDKKAPAGYVRNVVQA
FPASNAAEDNFVSVFSDDNVHACSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.02G074200.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg6g018770.1 orthology 0.139 3 271.2 3.7e-73
Cm050050.1 orthology 0.139 3 271.2 6.2e-73
Cs6g17860.1 orthology 0.139 3 271.2 4e-73
Manes.01G115000.1 ultra-paralogy 0.119 0 - -
maldo_pan_p022588 orthology 0.191 2 - -
thecc_pan_p003496 orthology 0.128 2 271 3.75e-95